Catalog# RPA756Ra02
Product name: Recombinant Mucin 5 Subtype AC (MUC5AC)
Uniprot id:
Purity: >= 98%
Host: E.coli
Predicted Molecular Mass: 17.4kDa
Fragment: Val324~Gln406+VGTPLRVEGFWQAWSGIGTLILNFLLLPVSRSSSTTRS
Organism Species: Rattus norvegicus (Rat)
Pack Size: 50ug
Tag: two N-terminal Tags, His-tag and T7-tag
Expression System: Prokaryotic expression
Aplication: SDS-PAGE; WB; ELISA; IP.
Weblink: http://www.cloud-clone.com/products/RPA756Ra02.html
Alternative Names: TBM; MUC5; LeB; Oligomeric Mucus/Gel-Forming; Mucin 5,Subtypes A And C,Tracheobronchial/Gastric; Gastric mucin; Lewis B blood group antigen; Major airway glycoprotein
Add to CartDo you have a question
or comment about a Sunny Corp.
product or service?
Customer Service
(+91)-11-41033012
(+91)-9818667300
Sunny Corporation Pvt. Ltd.
Plot # 63, III Floor, DSIDC Complex,
Phase- I , Okhla Industrial Area,
New Delhi - 110020.
India